L3MBTL2 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA10331S
| Article Name: |
L3MBTL2 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: |
MBL-CNA10331S |
| Supplier Catalog Number: |
CNA10331S |
| Alternative Catalog Number: |
MBL-CNA10331S |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 486-705 of human L3MBTL2 (NP_113676.2). |
| Conjugation: |
Unconjugated |
| Alternative Names: |
L3MBT, H-l(3)mbt-l |
| Clonality: |
Polyclonal |
| Molecular Weight: |
79kDa |
| NCBI: |
83746 |
| Buffer: |
PBS with 0.02% sodium azide,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.02% sodium azide,50% glycerol |
| Sequence: |
PATFCQKNDIELTPPKGYEAQTFNWENYLEKTKSKAAPSRLFNMDCPNHGFKVGMKLEAVDLMEPRLICVATVKRVVHRLLSIHFDGWDSEYDQWVDCESPDIYPVGWCELTGYQLQPPVAAEPATPLKAKEATKKKKKQFGKKRKRIPPTKTRPLRQGSKKPLLEDDPQGARKISSEPVPGEIIAVRVKEEHLDVASPDKASSPELPVSVENIKQETDD |
| Target: |
L3MBTL2 |
| Application Dilute: |
WB: WB,1:1000 - 1:2000 |
