RAB34 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10332S
Article Name: RAB34 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10332S
Supplier Catalog Number: CNA10332S
Alternative Catalog Number: MBL-CNA10332S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-259 of human RAB34 (NP_114140.4).
Conjugation: Unconjugated
Alternative Names: RAH, NARR, RAB39
Clonality: Polyclonal
Molecular Weight: 21kDa/28kDa/29kDa
NCBI: 83871
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MNILAPVRRDRVLAELPQCLRKEAALHGHKDFHPRVTCACQEHRTGTVGFKISKVIVVGDLSVGKTCLINRFCKDTFDKNYKATIGVDFEMERFEVLGIPFSLQLWDTAGQERFKCIASTYYRGAQAIIIVFNLNDVASLEHTKQWLADALKENDPSSVLLFLVGSKKDLSTPAQYALMEKDALQVAQEMKAEYWAVSSLTGENVREFFFRVAALTFEANVLAELEKSGARRIGDVVRINSDDSNLYLTASKKK
Target: RAB34
Application Dilute: WB: WB,1:500 - 1:2000