STRIP1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10334S
Article Name: STRIP1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10334S
Supplier Catalog Number: CNA10334S
Alternative Catalog Number: MBL-CNA10334S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 743-837 of human STRIP1 (NP_149079.2).
Conjugation: Unconjugated
Alternative Names: FAM40A, FAR11A
Clonality: Polyclonal
Molecular Weight: 96kDa
NCBI: 85369
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: VRHRLNDDWAYGNDLDARPWDFQAEECALRANIERFNARRYDRAHSNPDFLPVDNCLQSVLGQRVDLPEDFQMNYDLWLEREVFSKPISWEELLQ
Target: STRIP1
Application Dilute: WB: WB,1:1000 - 1:2000|IF/ICC,1:50 - 1:200