KIAA0101 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA10357T
Article Name: |
KIAA0101 Rabbit pAb, Unconjugated, Polyclonal |
Biozol Catalog Number: |
MBL-CNA10357T |
Supplier Catalog Number: |
CNA10357T |
Alternative Catalog Number: |
MBL-CNA10357T |
Manufacturer: |
MBL |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Species Reactivity: |
Human |
Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 39-111 of human KIAA0101 (NP_055551.1). |
Conjugation: |
Unconjugated |
Alternative Names: |
L5, PAF, OEATC, PAF15, OEATC1, p15PAF, NS5ATP9, OEATC-1, p15/PAF, KIAA0101, p15(PAF) |
Clonality: |
Polyclonal |
Molecular Weight: |
12kDa |
NCBI: |
9768 |
Buffer: |
PBS with 0.01% thimerosal,50% glycerol |
Source: |
Rabbit |
Purity: |
Affinity purification |
Form: |
PBS with 0.01% thimerosal,50% glycerol |
Sequence: |
SSRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE |
Target: |
PCLAF |
Application Dilute: |
WB: WB,1:500 - 1:2000 |