KIAA0101 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA10357T
| Article Name: |
KIAA0101 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: |
MBL-CNA10357T |
| Supplier Catalog Number: |
CNA10357T |
| Alternative Catalog Number: |
MBL-CNA10357T |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 39-111 of human KIAA0101 (NP_055551.1). |
| Conjugation: |
Unconjugated |
| Alternative Names: |
L5, PAF, OEATC, PAF15, OEATC1, p15PAF, NS5ATP9, OEATC-1, p15/PAF, KIAA0101, p15(PAF) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
12kDa |
| NCBI: |
9768 |
| Buffer: |
PBS with 0.01% thimerosal,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.01% thimerosal,50% glycerol |
| Sequence: |
SSRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE |
| Target: |
PCLAF |
| Application Dilute: |
WB: WB,1:500 - 1:2000 |
