HNRPLL Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10360S
Article Name: HNRPLL Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10360S
Supplier Catalog Number: CNA10360S
Alternative Catalog Number: MBL-CNA10360S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 250-350 of human HNRPLL (NP_612403.2).
Conjugation: Unconjugated
Alternative Names: SRRF, HNRPLL
Clonality: Polyclonal
Molecular Weight: 60kDa
NCBI: 92906
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: IRNDNDSWDYTKPYLGRRDRGKGRQRQAILGEHPSSFRHDGYGSHGPLLPLPSRYRMGSRDTPELVAYPLPQASSSYMHGGNPSGSVVMVSGLHQLKMNCS
Target: HNRNPLL
Application Dilute: WB: WB,1:500 - 1:2000