INPP1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10372S
Article Name: INPP1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10372S
Supplier Catalog Number: CNA10372S
Alternative Catalog Number: MBL-CNA10372S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human INPP1 (NP_002185.1).
Conjugation: Unconjugated
Alternative Names: INPP1
Clonality: Polyclonal
Molecular Weight: 44kDa
NCBI: 3628
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MSDILRELLCVSEKAANIARACRQQEALFQLLIEEKKEGEKNKKFAVDFKTLADVLVQEVIKQNMENKFPGLEKNIFGEESNEFTNDWGEKITLRLCSTEEETAELLSKVLNGNKVASEALARVVHQDVAFTDPTLDSTEINVPQDILGIWVDPIDSTYQYIKGSADIKSNQGIFPCGLQ
Target: INPP1
Application Dilute: WB: WB,1:500 - 1:2000