SLC29A3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10377S
Article Name: SLC29A3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10377S
Supplier Catalog Number: CNA10377S
Alternative Catalog Number: MBL-CNA10377S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human SLC29A3 (NP_060814.4).
Conjugation: Unconjugated
Alternative Names: ENT3, HJCD, PHID, HCLAP
Clonality: Polyclonal
Molecular Weight: 52kDa
NCBI: 55315
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MAVVSEDDFQHSSNSTYRTTSSSLRADQEALLEKLLDRPPPGLQRPEDRFCGTYIIFFSLGIGSLLPWNFFITAKEYWMFKLRNSSSPATGEDPEGSDILNYFESYLAVA
Target: SLC29A3
Application Dilute: WB: WB,1:500 - 1:2000