PPFIA1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10388S
Article Name: PPFIA1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10388S
Supplier Catalog Number: CNA10388S
Alternative Catalog Number: MBL-CNA10388S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 660-800 of human PPFIA1 (NP_003617.1).
Conjugation: Unconjugated
Alternative Names: LIP1, LIP.1, LIPRIN
Clonality: Polyclonal
Molecular Weight: 136kDa
NCBI: 8500
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: IESRVGSGSLDNLGRFRSMSSIPPYPASSLASSSPPGSGRSTPRRIPHSPAREVDRLGVMTLLPPSREEVRDDKTTIKCETSPPSSPRALRLDRLHKGALHTVSHEDIRDIRNSTGSQDGPVSNPSSSNSSQDSLHKAPKK
Target: PPFIA1
Application Dilute: WB: WB,1:500 - 1:2000