MVP Rabbit mAb, Clone: [ARC1855], Unconjugated, Monoclonal

Catalog Number: MBL-CNA1039S
Article Name: MVP Rabbit mAb, Clone: [ARC1855], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA1039S
Supplier Catalog Number: CNA1039S
Alternative Catalog Number: MBL-CNA1039S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MVP (Q14764).
Conjugation: Unconjugated
Alternative Names: LRP, VAULT1
Clonality: Monoclonal
Clone Designation: [ARC1855]
Molecular Weight: 99kDa
NCBI: 9961
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MATEEFIIRIPPYHYIHVLDQNSNVSRVEVGPKTYIRQDNERVLFAPMRMVTVPPRHYCTVANPVSRDAQGLVLFDVTGQVRLRHADLEIRLAQDPFPLY
Target: MVP
Application Dilute: WB: WB,1:100 - 1:500