Exportin 2 (XPO2) Rabbit mAb, Clone: [ARC1856], Unconjugated, Monoclonal

Catalog Number: MBL-CNA1041S
Article Name: Exportin 2 (XPO2) Rabbit mAb, Clone: [ARC1856], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA1041S
Supplier Catalog Number: CNA1041S
Alternative Catalog Number: MBL-CNA1041S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 872-971 of human Exportin 2 (XPO2) (P55060).
Conjugation: Unconjugated
Alternative Names: CAS, CSE1, XPO2
Clonality: Monoclonal
Clone Designation: [ARC1856]
Molecular Weight: 110kDa
NCBI: 1434
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: LIGLFELPEDDTIPDEEHFIDIEDTPGYQTAFSQLAFAGKKEHDPVGQMVNNPKIHLAQSLHKLSTACPGRVPSMVSTSLNAEALQYLQGYLQAASVTLL
Target: CSE1L
Application Dilute: WB: WB,1:500 - 1:1000