JTB Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10427S
Article Name: JTB Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10427S
Supplier Catalog Number: CNA10427S
Alternative Catalog Number: MBL-CNA10427S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 31-105 of human JTB (NP_006685.1).
Conjugation: Unconjugated
Alternative Names: PAR, hJT, HJTB, HSPC222
Clonality: Polyclonal
Molecular Weight: 16kDa
NCBI: 10899
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: EAPVQEEKLSASTSNLPCWLVEEFVVAEECSPCSNFRAKTTPECGPTGYVEKITCSSSKRNEFKSCRSALMEQRL
Target: JTB
Application Dilute: WB: WB,1:500 - 1:2000