ORP150/GRP170/HSP12A Rabbit mAb, Clone: [ARC1857], Unconjugated, Monoclonal

Catalog Number: MBL-CNA1042S
Article Name: ORP150/GRP170/HSP12A Rabbit mAb, Clone: [ARC1857], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA1042S
Supplier Catalog Number: CNA1042S
Alternative Catalog Number: MBL-CNA1042S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human ORP150/GRP170/HSP12A (Q9Y4L1).
Conjugation: Unconjugated
Alternative Names: IMD59, Grp170, HSP12A, ORP150, GRP-170, ORP-150
Clonality: Monoclonal
Clone Designation: [ARC1857]
Molecular Weight: 111kDa
NCBI: 10525
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MADKVRRQRPRRRVCWALVAVLLADLLALSDTLAVMSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVIVTLKENERFFGDSAASMAIKNPKATLRYFQHLLGKQADNPHVALYQARFPEHELTFDPQRQTVHFQISSQLQFSPEEVL
Target: HYOU1
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200