SEMA4F Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10432S
Article Name: SEMA4F Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10432S
Supplier Catalog Number: CNA10432S
Alternative Catalog Number: MBL-CNA10432S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 280-420 of human SEMA4F (NP_004254.2).
Conjugation: Unconjugated
Alternative Names: S4F, SEMAM, SEMAW, M-SEMA, PRO2353, m-Sema-M
Clonality: Polyclonal
Molecular Weight: 84kDa
NCBI: 10505
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: RKTLQQRWTTFLKADLLCPGPEHGRASSVLQDVAVLRPELGAGTPIFYGIFSSQWEGATISAVCAFRPQDIRTVLNGPFRELKHDCNRGLPVVDNDVPQPRPGECITNNMKLRHFGSSLSLPDRVLTFIRDHPLMDRPVFP
Target: SEMA4F
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200