SLC4A5 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10436S
Article Name: SLC4A5 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10436S
Supplier Catalog Number: CNA10436S
Alternative Catalog Number: MBL-CNA10436S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1042-1121 of human SLC4A5 (NP_597812.1).
Conjugation: Unconjugated
Alternative Names: NBC4, NBCe2
Clonality: Polyclonal
Molecular Weight: 126kDa
NCBI: 57835
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: DFIFSQHDLAWIDNILPEKEKKETDKKRKRKKGAHEDCDEEPQFPPPSVIKIPMESVQSDPQNGIHCIARKRSSSWSYSL
Target: SLC4A5
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200