LMAN1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10440T
Article Name: LMAN1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10440T
Supplier Catalog Number: CNA10440T
Alternative Catalog Number: MBL-CNA10440T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 270-480 of human LMAN1 (NP_005561.1).
Conjugation: Unconjugated
Alternative Names: MR60, gp58, F5F8D, FMFD1, MCFD1, ERGIC53, ERGIC-53
Clonality: Polyclonal
Molecular Weight: 54kDa
NCBI: 3998
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: PGKEPPTPDKEISEKEKEKYQEEFEHFQQELDKKKEEFQKGHPDLQGQPAEEIFESVGDRELRQVFEGQNRIHLEIKQLNRQLDMILDEQRRYVSSLTEEISKRGAGMPGQHGQITQQELDTVVKTQHEILRQVNEMKNSMSETVRLVSGMQHPGSAGGVYETTQHFIDIKEHLHIVKRDIDNLVQRNMPSNEKPKCPELPPFPSCLSTVH
Target: LMAN1
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:100|IF/ICC,1:50 - 1:200