beta-Synuclein Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10443S
Article Name: beta-Synuclein Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10443S
Supplier Catalog Number: CNA10443S
Alternative Catalog Number: MBL-CNA10443S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-134 of human beta-Synuclein (NP_001001502.1).
Conjugation: Unconjugated
Alternative Names: SNCB
Clonality: Polyclonal
Molecular Weight: 14kDa
NCBI: 6620
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTREGVVQGVASVAEKTKEQASHLGGAVFSGAGNIAAATGLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYEPEA
Target: SNCB
Application Dilute: WB: WB,1:500 - 1:2000