CYC1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10449S
Article Name: CYC1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10449S
Supplier Catalog Number: CNA10449S
Alternative Catalog Number: MBL-CNA10449S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 85-291 of human CYC1 (NP_001907.2).
Conjugation: Unconjugated
Alternative Names: UQCR4, MC3DN6
Clonality: Polyclonal
Molecular Weight: 35kDa
NCBI: 1537
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCASCHSMDFVAYRHLVGVCYTEDEAKELAAEVEVQDGPNEDGEMFMRPGKLFDYFPKPYPNSEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIAMAPPIYTDVLEFDDGTPATMSQIAKDVCTFLRWASEPEHDHRKRMGLK
Target: CYC1
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:100 - 1:200