FCRL3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10452S
Article Name: FCRL3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10452S
Supplier Catalog Number: CNA10452S
Alternative Catalog Number: MBL-CNA10452S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 18-180 of human FCRL3 (NP_443171.2).
Conjugation: Unconjugated
Alternative Names: MAIA, FCRH3, IFGP3, IRTA3, SPAP2, CD307c
Clonality: Polyclonal
Molecular Weight: 81kDa
NCBI: 115352
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: GVAPKAVLLLNPPWSTAFKGEKVALICSSISHSLAQGDTYWYHDEKLLKIKHDKIQITEPGNYQCKTRGSSLSDAVHVEFSPDWLILQALHPVFEGDNVILRCQGKDNKNTHQKVYYKDGKQLPNSYNLEKITVNSVSRDNSKYHCTAYRKFYILDIEVTSKP
Target: FCRL3
Application Dilute: WB: WB,1:500 - 1:2000