PDE1A Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10457S
Article Name: PDE1A Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10457S
Supplier Catalog Number: CNA10457S
Alternative Catalog Number: MBL-CNA10457S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 446-545 of human PDE1A (NP_005010.2).
Conjugation: Unconjugated
Alternative Names: HCAM1, HCAM-1, HSPDE1A, CAM-PDE 1A, CAM-PDE-1A
Clonality: Polyclonal
Molecular Weight: 61kDa
NCBI: 5136
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: EASKAETSSYVASSSTTIVGLHIADALRRSNTKGSMSDGSYSPDYSLAAVDLKSFKNNLVDIIQQNKERWKELAAQGESDLHKNSEDLVNAEEKHDETHS
Target: PDE1A
Application Dilute: WB: WB,1:500 - 1:2000