PEX6 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10459S
Article Name: PEX6 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10459S
Supplier Catalog Number: CNA10459S
Alternative Catalog Number: MBL-CNA10459S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 741-980 of human PEX6 (NP_000278.3).
Conjugation: Unconjugated
Alternative Names: PAF2, HMLR2, PAF-2, PBD4A, PDB4B, PXAAA1
Clonality: Polyclonal
Molecular Weight: 104kDa
NCBI: 5190
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: LLHGPPGTGKTLLAKAVATECSLTFLSVKGPELINMYVGQSEENVREVFARARAAAPCIIFFDELDSLAPSRGRSGDSGGVMDRVVSQLLAELDGLHSTQDVFVIGATNRPDLLDPALLRPGRFDKLVFVGANEDRASQLRVLSAITRKFKLEPSVSLVNVLDCCPPQLTGADLYSLCSDAMTAALKRRVHDLEEGLEPGSSALMLTMEDLLQAAARLQPSVSEQELLRYKRIQRKFAAC
Target: PEX6
Application Dilute: WB: WB,1:500 - 1:2000