RFWD2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10463S
Article Name: RFWD2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10463S
Supplier Catalog Number: CNA10463S
Alternative Catalog Number: MBL-CNA10463S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 582-731 of human RFWD2 (NP_071902.2).
Conjugation: Unconjugated
Alternative Names: FAP78, RFWD2, CFAP78, RNF200
Clonality: Polyclonal
Molecular Weight: 80kDa
NCBI: 64326
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: YYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPYCLRSFKGHINEKNFVGLASNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFVSAVCWRALPDGESNVLIAANSQGTIKVLELV
Target: COP1
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:100 - 1:200