ARAP1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10466S
Article Name: ARAP1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10466S
Supplier Catalog Number: CNA10466S
Alternative Catalog Number: MBL-CNA10466S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 834-1133 of human ARAP1 (NP_001128662.1).
Conjugation: Unconjugated
Alternative Names: CENTD2, cnt-d2
Clonality: Polyclonal
Molecular Weight: 162kDa
NCBI: 116985
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: SVDEEELRKQREEITAIVKMRVAGTASGTQHAGDFICTVYLEEKKAETEQHIKVPASMTAEELTLEILDRRNVGIREKDYWTCFEVNEREEAERPLHFAEKVLPILHGLGTDSHLVVKKHQAMEAMLLYLASRVGDTKHGMMKFREDRSLLGLGLPSGGFHDRYFILNSSCLRLYKEVRSHRPEKEWPIKSLKVYLGVKKKLRPPTCWGFTVVHETEKHEKQQWYLCCDTQMELREWFATFLFVQHDGLVWPSE
Target: ARAP1
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200