TREM2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10482P
Article Name: TREM2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10482P
Supplier Catalog Number: CNA10482P
Alternative Catalog Number: MBL-CNA10482P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 19-161 of human TREM2 (NP_061838.1).
Conjugation: Unconjugated
Alternative Names: PLOSL2, TREM-2, Trem2a, Trem2b, Trem2c
Clonality: Polyclonal
Molecular Weight: 25kDa
NCBI: 54209
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISR
Target: TREM2
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200