SLC22A4 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10490S
Article Name: SLC22A4 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10490S
Supplier Catalog Number: CNA10490S
Alternative Catalog Number: MBL-CNA10490S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 42-141 of human SLC22A4 (NP_003050.2).
Conjugation: Unconjugated
Alternative Names: OCTN1, DFNB60
Clonality: Polyclonal
Molecular Weight: 62kDa
NCBI: 6583
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: LAGTPEHRCRVPDAANLSSAWRNNSVPLRLRDGREVPHSCSRYRLATIANFSALGLEPGRDVDLGQLEQESCLDGWEFSQDVYLSTVVTEWNLVCEDNWK
Target: SLC22A4
Application Dilute: WB: WB,1:1000 - 1:2000