ANO1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10498P
Article Name: ANO1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10498P
Supplier Catalog Number: CNA10498P
Alternative Catalog Number: MBL-CNA10498P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 400-500 of human ANO1 (NP_060513.5).
Conjugation: Unconjugated
Alternative Names: DOG1, INDMS, TAOS2, ORAOV2, TMEM16A
Clonality: Polyclonal
Molecular Weight: 114kDa
NCBI: 55107
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: ASHLFDNPATVFFSVFMALWAATFMEHWKRKQMRLNYRWDLTGFEEEEEAVKDHPRAEYEARVLEKSLKKESRNKEKRRHIPEESTNKWKQRVKTAMAGVK
Target: ANO1
Application Dilute: WB: WB,1:1000 - 1:2000|IF/ICC,1:100 - 1:200