KREMEN1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10507S
Article Name: KREMEN1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10507S
Supplier Catalog Number: CNA10507S
Alternative Catalog Number: MBL-CNA10507S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 180-380 of human KREMEN1 (NP_001034659.2).
Conjugation: Unconjugated
Alternative Names: KRM1, ECTD13, KREMEN
Clonality: Polyclonal
Molecular Weight: 52kDa
NCBI: 83999
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: YGEAASTECNSVCFGDHTQPCGGDGRIILFDTLVGACGGNYSAMSSVVYSPDFPDTYATGRVCYWTIRVPGASHIHFSFPLFDIRDSADMVELLDGYTHRVLARFHGRSRPPLSFNVSLDFVILYFFSDRINQAQGFAVLYQAVKEELPQERPAVNQTVAEVITEQANLSVSAARSSKVLYVITTSPSHPPQTVPGWTVYG
Target: KREMEN1
Application Dilute: WB: WB,1:500 - 1:2000