NOMO1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10510S
Article Name: NOMO1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10510S
Supplier Catalog Number: CNA10510S
Alternative Catalog Number: MBL-CNA10510S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 700-1000 of human NOMO1 (NP_055102.3).
Conjugation: Unconjugated
Alternative Names: PM5, Nomo
Clonality: Polyclonal
Molecular Weight: 134kDa
NCBI: 23420
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: KSVQELRREQQLAEIEARRQEREKNGNEEGEERMTKPPVQEMVDELQGPFSYDFSYWARSGEKITVTPSSKELLFYPPSMEAVVSGESCPGKLIEIHGKAGLFLEGQIHPELEGVEIVISEKGASSPLITVFTDDKGAYSVGPLHSDLEYTVTSQKEGYVLTAVEGTIGDFKAYALAGVSFEIKAEDDQPLPGVLLSLSGGLFRSNLLTQDNGILTFSNLSPGQYYFKPMMKEFRFEPSSQMIEVQEGQNLKIT
Target: NOMO1
Application Dilute: WB: WB,1:1000 - 1:2000|IHC-P,1:100 - 1:500