Siglec-8 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10514S
Article Name: Siglec-8 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10514S
Supplier Catalog Number: CNA10514S
Alternative Catalog Number: MBL-CNA10514S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 17-363 of human Siglec-8 (NP_055257.2).
Conjugation: Unconjugated
Alternative Names: SAF2, SIGLEC-8, SIGLEC8L
Clonality: Polyclonal
Molecular Weight: 54kDa
NCBI: 27181
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MEGDRQYGDGYLLQVQELVTVQEGLCVHVPCSFSYPQDGWTDSDPVHGYWFRAGDRPYQDAPVATNNPDREVQAETQGRFQLLGDIWSNDCSLSIRDARKRDKGSYFFRLERGSMKWSYKSQLNYKTKQLSVFVTALTHRPDILILGTLESGHSRNLTCSVPWACKQGTPPMISWIGASVSSPGPTTARSSVLTLTPKPQDHGTSLTCQVTLPGTGVTTTSTVRLDVSYPPWNLTMTVFQGDATASTALGNGSS
Target: SIGLEC8
Application Dilute: WB: WB,1:500 - 1:2000