ApoER2/LRP8 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10517S
Article Name: ApoER2/LRP8 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10517S
Supplier Catalog Number: CNA10517S
Alternative Catalog Number: MBL-CNA10517S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 900 to the C-terminus of human ApoER2/ApoER2/LRP8 (NP_004622.2).
Conjugation: Unconjugated
Alternative Names: MCI1, LRP-8, APOER2, HSZ75190
Clonality: Polyclonal
Molecular Weight: 106kDa
NCBI: 7804
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: PLWAEPCLGETREPEDPAPALKELFVLPGEPRSQLHQLPKNPLSELPVVKSKRVALSLEDDGLP
Target: LRP8
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200