P4HA1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10538P
Article Name: P4HA1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10538P
Supplier Catalog Number: CNA10538P
Alternative Catalog Number: MBL-CNA10538P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human P4HA1 (NP_001017962.1).
Conjugation: Unconjugated
Alternative Names: P4HA
Clonality: Polyclonal
Molecular Weight: 61kDa
NCBI: 5033
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: STIDKVSVLDYLSYAVYQQGDLDKALLLTKKLLELDPEHQRANGNLKYFEYIMAKEKDVNKSASDDQSDQKTTPKKKGVAVDYLPERQKYEMLCRGEGIKM
Target: P4HA1
Application Dilute: WB: WB,1:100 - 1:500|IF/ICC,1:50 - 1:200