VDAC3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10544P
Article Name: VDAC3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10544P
Supplier Catalog Number: CNA10544P
Alternative Catalog Number: MBL-CNA10544P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human VDAC3 (NP_005653.3).
Conjugation: Unconjugated
Alternative Names: VDAC-3, HD-VDAC3
Clonality: Polyclonal
Molecular Weight: 31kDa
NCBI: 7419
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: DTIFVPNTGKKSGKLKASYKRDCFSVGSNVDIDFSGPTIYGWAVLAFEGWLAGYQMSFDTAKSKLSQNNFALGYKAADFQLHTHVNDGTEFGGSIYQKVNE
Target: VDAC3
Application Dilute: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200