TRIM24 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10546T
Article Name: TRIM24 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10546T
Supplier Catalog Number: CNA10546T
Alternative Catalog Number: MBL-CNA10546T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 600-820 of human TRIM24 (NP_056989.2).
Conjugation: Unconjugated
Alternative Names: PTC6, TF1A, TIF1, RNF82, TIF1A, hTIF1, TIF1ALPHA
Clonality: Polyclonal
Molecular Weight: 117kDa
NCBI: 8805
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: DGKAFGSPMIDLSSPVGGSYNLPSLPDIDCSSTIMLDNIVRKDTNIDHGQPRPPSNRTVQSPNSSVPSPGLAGPVTMTSVHPPIRSPSASSVGSRGSSGSSSKPAGADSTHKVPVVMLEPIRIKQENSGPPENYDFPVVIVKQESDEESRPQNANYPRSILTSLLLNSSQSSTSEETVLRSDAPDSTGDQPGLHQDNSSNGKSEWLDPSQKSPLHVGETRK
Target: TRIM24
Application Dilute: WB: WB,1:1000 - 1:2000