MCT4/SLC16A3 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA10548P
| Article Name: |
MCT4/SLC16A3 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: |
MBL-CNA10548P |
| Supplier Catalog Number: |
CNA10548P |
| Alternative Catalog Number: |
MBL-CNA10548P |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC-P, WB |
| Species Reactivity: |
Human, Mouse, Rat |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 371-465 of human MCT4/SLC16A3 (NP_004198.1). |
| Conjugation: |
Unconjugated |
| Alternative Names: |
MCT3, MCT4, MCT 3, MCT 4, MCT-3, MCT-4 |
| Clonality: |
Polyclonal |
| Molecular Weight: |
49kDa |
| NCBI: |
9123 |
| Buffer: |
PBS with 0.05% proclin300,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.05% proclin300,50% glycerol |
| Sequence: |
PPSGGKLLDATHVYMYVFILAGAEVLTSSLILLLGNFFCIRKKPKEPQPEVAAAEEEKLHKPPADSGVDLREVEHFLKAEPEKNGEVVHTPETSV |
| Target: |
SLC16A3 |
| Application Dilute: |
WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200 |
