[KO Validated] HK1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1054T
Article Name: [KO Validated] HK1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1054T
Supplier Catalog Number: CNA1054T
Alternative Catalog Number: MBL-CNA1054T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 21-219 of human HK1 (NP_000179.2).
Conjugation: Unconjugated
Alternative Names: HK, HKD, HKI, HXK1, NMSR, RP79, HMSNR, HK1-ta, HK1-tb, HK1-tc, NEDVIBA, hexokinase
Clonality: Polyclonal
Molecular Weight: 102kDa
NCBI: 3098
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: KIDKYLYAMRLSDETLIDIMTRFRKEMKNGLSRDFNPTATVKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVHMESEVYDTPENIVHGSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCQQSKIDEAILITWTKRFKASGVEGADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGY
Target: HK1
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,1:100 - 1:500