SEC11A Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10552T
Article Name: SEC11A Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10552T
Supplier Catalog Number: CNA10552T
Alternative Catalog Number: MBL-CNA10552T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 37-145 of human SEC11A (NP_055115.1).
Conjugation: Unconjugated
Alternative Names: SPC18, SPCS4A, SEC11L1, sid2895, 1810012E07Rik
Clonality: Polyclonal
Molecular Weight: 21kDa
NCBI: 23478
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: KGLMVITGSESPIVVVLSGSMEPAFHRGDLLFLTNRVEDPIRVGEIVVFRIEGREIPIVHRVLKIHEKQNGHIKFLTKGDNNAVDDRGLYKQGQHWLEKKDVVGRARGF
Target: SEC11A
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200