CDH4 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10557T
Article Name: CDH4 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10557T
Supplier Catalog Number: CNA10557T
Alternative Catalog Number: MBL-CNA10557T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 757-916 of human CDH4 (NP_001785.2).
Conjugation: Unconjugated
Alternative Names: CAD4, RCAD, R-CAD
Clonality: Polyclonal
Molecular Weight: 100kDa
NCBI: 1002
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: KRREKERHTKQLLIDPEDDVRDNILKYDEEGGGEEDQDYDLSQLQQPEAMGHVPSKAPGVRRVDERPVGAEPQYPIRPMVPHPGDIGDFINEGLRAADNDPTAPPYDSLLVFDYEGSGSTAGSVSSLNSSSSGDQDYDYLNDWGPRFKKLADMYGGGEED
Target: CDH4
Application Dilute: WB: WB,1:1000 - 1:2000