PRMT1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1055P
Article Name: PRMT1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1055P
Supplier Catalog Number: CNA1055P
Alternative Catalog Number: MBL-CNA1055P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 270-371 of human PRMT1 (NP_001527.3).
Conjugation: Unconjugated
Alternative Names: ANM1, HCP1, IR1B4, HRMT1L2
Clonality: Polyclonal
Molecular Weight: 42kDa
NCBI: 3276
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: PFCLQVKRNDYVHALVAYFNIEFTRCHKRTGFSTSPESPYTHWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLDFKGQLCELSCSTDYRMR
Target: PRMT1
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200