MCM2 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA1056S
| Article Name: |
MCM2 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: |
MBL-CNA1056S |
| Supplier Catalog Number: |
CNA1056S |
| Alternative Catalog Number: |
MBL-CNA1056S |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human, Mouse |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 360-700 of human MCM2 (NP_004517.2). |
| Conjugation: |
Unconjugated |
| Alternative Names: |
BM28, CCNL1, CDCL1, cdc19, DFNA70, D3S3194, MITOTIN |
| Clonality: |
Polyclonal |
| Molecular Weight: |
102kDa |
| NCBI: |
4171 |
| Buffer: |
PBS with 0.02% sodium azide,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.02% sodium azide,50% glycerol |
| Sequence: |
PFEVNMEETIYQNYQRIRIQESPGKVAAGRLPRSKDAILLADLVDSCKPGDEIELTGIYHNNYDGSLNTANGFPVFATVILANHVAKKDNKVAVGELTDEDVKMITSLSKDQQIGEKIFASIAPSIYGHEDIKRGLALALFGGEPKNPGGKHKVRGDINVLLCGDPGTAKSQFLKYIEKVSSRAIFTTGQGASAVGLTAYVQRHPVSREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISK |
| Target: |
MCM2 |
| Application Dilute: |
WB: WB,1:500 - 1:2000 |
