SEC14L2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10586T
Article Name: SEC14L2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10586T
Supplier Catalog Number: CNA10586T
Alternative Catalog Number: MBL-CNA10586T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 60-270 of human SEC14L2 (NP_001191133.1).
Conjugation: Unconjugated
Alternative Names: SPF, TAP, TAP1, C22orf6
Clonality: Polyclonal
Molecular Weight: 46kDa
NCBI: 23541
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: GRKVETITIIYDCEGLGLKHLWKPAVEAYGEFLCMFEENYPETLKRLFVVKAPKLFPVAYNLIKPFLSEDTRKKIMVLGANWKEVLLKHISPDQVPVEYGGTMTDPDGNPKCKSKINYGGDIPRKYYVRDQVKQQYEHSVQISRGSSHQVEYEILFPGCVLRWQFMSDGADVGFGIFLKTKMGERQRAGEMTEVLPNQRYNSHLVPEDGTL
Target: SEC14L2
Application Dilute: WB: WB,1:1000 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:100