SRPRB Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10591T
Article Name: SRPRB Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10591T
Supplier Catalog Number: CNA10591T
Alternative Catalog Number: MBL-CNA10591T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 57-271 of human SRPRB (NP_067026.3).
Conjugation: Unconjugated
Alternative Names: APMCF1, SR-beta
Clonality: Polyclonal
Molecular Weight: 30kDa
NCBI: 58477
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: IRSRRSSQRAVLLVGLCDSGKTLLFVRLLTGLYRDTQTSITDSCAVYRVNNNRGNSLTLIDLPGHESLRLQFLERFKSSARAIVFVVDSAAFQREVKDVAEFLYQVLIDSMGLKNTPSFLIACNKQDIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLDSSSTAPAQLGKKGKEFEFSQLPLKVEFLECSAKGGRGDVGSADIQDLEKWLAKIA
Target: SRPRB
Application Dilute: WB: WB,1:1000 - 1:2000|IF/ICC,1:50 - 1:200