MARCH9 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10596S
Article Name: MARCH9 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10596S
Supplier Catalog Number: CNA10596S
Alternative Catalog Number: MBL-CNA10596S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 277-346 of human MARCH9 (NP_612405.2).
Conjugation: Unconjugated
Alternative Names: MARCH9, RNF179, MARCH-IX
Clonality: Polyclonal
Molecular Weight: 38kDa
NCBI: 92979
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: GTAGKSGPRNSRTGPTSGATSRPPAAQRMRTLLPQRCGYTILHLLGQLRPPDARSSSHSGREVVMRVTTV
Target: MARCHF9
Application Dilute: WB: WB,1:500 - 1:1000