TRMT61A Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10597P
Article Name: TRMT61A Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10597P
Supplier Catalog Number: CNA10597P
Alternative Catalog Number: MBL-CNA10597P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-289 of human TRMT61A (NP_689520.2).
Conjugation: Unconjugated
Alternative Names: GCD14, TRM61, Gcd14p, hTRM61, C14orf172
Clonality: Polyclonal
Molecular Weight: 31kDa
NCBI: 115708
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: MSFVAYEELIKEGDTAILSLGHGAMVAVRVQRGAQTQTRHGVLRHSVDLIGRPFGSKVTCGRGGWVYVLHPTPELWTLNLPHRTQILYSTDIALITMMLELRPGSVVCESGTGSGSVSHAIIRTIAPTGHLHTVEFHQQRAEKAREEFQEHRVGRWVTVRTQDVCRSGFGVSHVADAVFLDIPSPWEAVGHAWDALKVEGGRFCSFSPCIEQVQRTCQALAARGFSELSTLEVLPQVYNVRTVSLPPPDLGTGT
Target: TRMT61A
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200