MCM3 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA1060S
| Article Name: |
MCM3 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: |
MBL-CNA1060S |
| Supplier Catalog Number: |
CNA1060S |
| Alternative Catalog Number: |
MBL-CNA1060S |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IP, WB |
| Species Reactivity: |
Human, Mouse, Rat |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-295 of human MCM3 (NP_002379.2). |
| Conjugation: |
Unconjugated |
| Alternative Names: |
HCC5, P1.h, RLFB, P1-MCM3 |
| Clonality: |
Polyclonal |
| Molecular Weight: |
91kDa |
| NCBI: |
4172 |
| Buffer: |
PBS with 0.02% sodium azide,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.02% sodium azide,50% glycerol |
| Sequence: |
MAGTVVLDDVELREAQRDYLDFLDDEEDQGIYQSKVRELISDNQYRLIVNVNDLRRKNEKRANRLLNNAFEELVAFQRALKDFVASIDATYAKQYEEFYVGLEGSFGSKHVSPRTLTSCFLSCVVCVEGIVTKCSLVRPKVVRSVHYCPATKKTIERRYSDLTTLVAFPSSSVYPTKDEENNPLETEYGLSVYKDHQTITIQEMPEKAPAGQLPRSVDVILDDDLVDKAKPGDRVQVVGTYRCLPGKKGGYTSG |
| Target: |
MCM3 |
| Application Dilute: |
WB: WB,1:500 - 1:2000|IP,1:500 - 1:1000 |
