GCGR Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10617T
Article Name: GCGR Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10617T
Supplier Catalog Number: CNA10617T
Alternative Catalog Number: MBL-CNA10617T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human GCGR (NP_000151.1).
Conjugation: Unconjugated
Alternative Names: GGR, GL-R, MVAH
Clonality: Polyclonal
Molecular Weight: 54kDa
NCBI: 2642
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: LPPPTELVCNRTFDKYSCWPDTPANTTANISCPWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAKMYSSFQVMYTVGYS
Target: GCGR
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200