[KO Validated] RhoC Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1062S
Article Name: [KO Validated] RhoC Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1062S
Supplier Catalog Number: CNA1062S
Alternative Catalog Number: MBL-CNA1062S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-193 of human RhoC (NP_001036144.1).
Conjugation: Unconjugated
Alternative Names: H9, ARH9, ARHC, RHOH9
Clonality: Polyclonal
Molecular Weight: 22kDa
NCBI: 389
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPIL
Target: RHOC
Application Dilute: WB: WB,1:500 - 1:1000