FBXO6 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10634S
Article Name: FBXO6 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10634S
Supplier Catalog Number: CNA10634S
Alternative Catalog Number: MBL-CNA10634S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 70-260 of human FBXO6 (NP_060908.1).
Conjugation: Unconjugated
Alternative Names: FBG2, FBS2, FBX6, Fbx6b
Clonality: Polyclonal
Molecular Weight: 34kDa
NCBI: 26270
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: QPVADWKIFYFLRSLHRNLLRNPCAEEDMFAWQIDFNGGDRWKVESLPGAHGTDFPDPKVKKYFVTSYEMCLKSQLVDLVAEGYWEELLDTFRPDIVVKDWFAARADCGCTYQLKVQLASADYFVLASFEPPPVTIQQWNNATWTEVSYTFSDYPRGVRYILFQHGGRDTQYWAGWYGPRVTNSSIVVSPK
Target: FBXO6
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200