TRIM31 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10639S
Article Name: TRIM31 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10639S
Supplier Catalog Number: CNA10639S
Alternative Catalog Number: MBL-CNA10639S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 186-425 of human TRIM31 (NP_008959.3).
Conjugation: Unconjugated
Alternative Names: RNF, HCG1, HCGI, C6orf13
Clonality: Polyclonal
Molecular Weight: 48kDa
NCBI: 11074
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: ELLHQVLEEEKNFLLSRIYWLGHEGTEAGKHYVASTEPQLNDLKKLVDSLKTKQNMPPRQLLEDIKVVLCRSEEFQFLNPTPVPLELEKKLSEAKSRHDSITGSLKKFKDQLQADRKKDENRFFKSMNKNDMKSWGLLQKNNHKMNKTSEPGSSSAGGRTTSGPPNHHSSAPSHSLFRASSAGKVTFPVCLLASYDEISGQGASSQDTKTFDVALSEELHAALSEWLTAIRAWFCEVPSS
Target: TRIM31
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200