CRTC2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10682P
Article Name: CRTC2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10682P
Supplier Catalog Number: CNA10682P
Alternative Catalog Number: MBL-CNA10682P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 16-126 of human CRTC2 (NP_859066.1).
Conjugation: Unconjugated
Alternative Names: TORC2, TORC-2
Clonality: Polyclonal
Molecular Weight: 73kDa
NCBI: 200186
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: ASNPRKFSEKIALQKQRQAEETAAFEEVMMDIGSTRLQAQKLRLAYTRSSHYGGSLPNVNQIGSGLAEFQSPLHSPLDSSRSTRHHGLVERVQRDPRRMVSPLRRYTRHID
Target: CRTC2
Application Dilute: WB: WB,1:100 - 1:500