AKR1A1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1068S
Article Name: AKR1A1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1068S
Supplier Catalog Number: CNA1068S
Alternative Catalog Number: MBL-CNA1068S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-325 of human AKR1A1 (NP_006057.1).
Conjugation: Unconjugated
Alternative Names: ALR, ARM, DD3, ALDR1, HEL-S-6
Clonality: Polyclonal
Molecular Weight: 37kDa
NCBI: 10327
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MAASCVLLHTGQKMPLIGLGTWKSEPGQVKAAVKYALSVGYRHIDCAAIYGNEPEIGEALKEDVGPGKAVPREELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTICYDSTHYKETWKALEALVAKGLVQALGLSNFNSRQIDDILSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAWRDPDEPVLLEEPVVLALAEKYGRSPAQILLRWQV
Target: AKR1A1
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200