CACNA1H Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10697P
Article Name: CACNA1H Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10697P
Supplier Catalog Number: CNA10697P
Alternative Catalog Number: MBL-CNA10697P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF
Species Reactivity: Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1890-2030 of human CACNA1H (NP_066921.2).
Conjugation: Unconjugated
Alternative Names: ECA6, EIG6, HALD4, Cav3.2, CACNA1HB
Clonality: Polyclonal
Molecular Weight: 259kDa
NCBI: 8912
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: SARRVDADRPPLPQESPGARDAPNLVARKVSVSRMLSLPNDSYMFRPVVPASAPHPRPLQEVEMETYGAGTPLGSVASVHSPPAESCASLQIPLAVSSPARSGEPLHALSPRGTARSPSLSRLLCRQEAVHTDSLEGKIDS
Target: CACNA1H
Application Dilute: WB: IF/ICC,1:50 - 1:200